LL-37 5MG

Discounts available.

5 Products = 5% off order.

10 Products = 10% off order.

20 Products = 20% off order.

50 Products = 50% off order.

LL-37 is a synthetic antimicrobial peptide derived from the human cathelicidin protein (hCAP18). Known for its broad-spectrum antimicrobial and immunomodulatory properties, LL-37 plays a key role in research related to immune response, inflammation, and wound healing.

Key Features:
High Purity & Potency: Laboratory-grade LL-37, suitable for research purposes.
Antimicrobial Properties: Effective against a wide range of bacteria, viruses, and fungi in experimental models.
Immunomodulatory Potential: Studied for its role in reducing inflammation and promoting tissue repair.

Specifications:

Sequence: [LL-37, 37 aa]

Form: Lyophilized powder

Purity: ≥98%

Storage: Store in a cool, dry place. Reconstitute with bacteriostatic water or sterile solution before use.

Applications:

Microbial Resistance Research: Investigation of LL-37’s effectiveness against pathogens.

Wound Healing Studies: Evaluation of its tissue-repairing properties.

Inflammation Modulation: Exploration of its anti-inflammatory effects in vitro and in vivo.

Important:
LL-37 is strictly intended for research use only. Not for human consumption or therapeutic use. Handle with appropriate safety measures.